PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_C5050FD87.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 145aa    MW: 16755.4 Da    PI: 9.832
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_C5050FD87.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR134.95e-11631084390
                   FAR1  43 eekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            + kkk  k+ ++ +  +tgCk k++vk+  dg+wev+ ++ eHnH+l+
  Traes_4AL_C5050FD87.1  63 KLKKK-IKKLKRDKILQTGCKVKMVVKLI-DGRWEVIYFVAEHNHKLV 108
                            33333.6777889999*************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-865108IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MNTSRKTVDT HVLVKQXFVX NKFQKPIENX GGAEKPPVLD IIVDRAXHVD EDDDIVFLGD  60
ESKLKKKIKK LKRDKILQTG CKVKMVVKLI DGRWEVIYFV AEHNHKLVEK PSLKKYLRSH  120
QGIPPEEKAF PTHLHNYNLT TGEND
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16269KLKKKIKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5DTE94e-99W5DTE9_WHEAT; Uncharacterized protein
STRINGMLOC_74313.18e-56(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]